PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.19G017900.1.p
Common NameGLYMA_19G017900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 346aa    MW: 37747.2 Da    PI: 6.4152
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.19G017900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.7e-181461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         rg WT+eEd +++ +v  +G+g+W++++++ g++R++k+c++rw +yl
  Glyma.19G017900.1.p 14 RGLWTPEEDAKILAYVVNHGTGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                         788*******************************************97 PP

2Myb_DNA-binding44.43.9e-1470110446
                          S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +T++E+el+++++   G++ W+ Ia++++ gRt++++k++w++
  Glyma.19G017900.1.p  70 FTPQEEELIINLHGAIGSR-WSIIAKRLP-GRTDNDVKNYWNT 110
                          9******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.8E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.61965IPR017930Myb domain
SuperFamilySSF466893.38E-3011108IPR009057Homeodomain-like
SMARTSM007173.0E-141363IPR001005SANT/Myb domain
PfamPF002491.7E-161461IPR001005SANT/Myb domain
CDDcd001673.38E-111761No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2365116IPR009057Homeodomain-like
PROSITE profilePS5129417.15266116IPR017930Myb domain
SMARTSM007175.0E-1366114IPR001005SANT/Myb domain
CDDcd001672.01E-1070112No hitNo description
PfamPF002499.8E-1370110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTPE EDAKILAYVV NHGTGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDGF TPQEEELIIN LHGAIGSRWS IIAKRLPGRT DNDVKNYWNT KLRKKLMKMG  120
IDPVTHKPVS QVLSDLGSIS GLPNTTTNQI AFINKDLMMS NMLPITKTEP SGSNKSTVEH  180
TQEGQVPSWE HHIPYQVIIN SENIQSHVLS EAASSTSSSS SSNITQLGSP QSYSCQTPQA  240
QIAPPCSSFD WSEFLQSDSF NWSLNPSSGI IQSEAELSNN AKSNGNDMQG GASEGSGSGA  300
VACGASMEYQ INKQCEAHSF VDGILDRDSE IRAAFPELLD ASFDC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014627228.10.0PREDICTED: transcription factor MYB35-like
SwissprotQ9LSI75e-85MYB35_ARATH; Transcription factor MYB35
TrEMBLI1N6080.0I1N608_SOYBN; Uncharacterized protein
STRINGGLYMA19G02090.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.18e-84MYB family protein